PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 121aa    MW: 13767 Da    PI: 8.5827
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613397.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.56.4e-4051041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaC++lrr+C+kdCv++pyfp ++p+kfa+vh+++Ga nv+k+l++lp ++r +a++sl++eA +r++dPvyG+vg+i+ lq q++++++ la
  XP_013613397.1   5 RCAACRYLRRRCPKDCVFSPYFPPNNPEKFACVHRIYGAGNVSKMLQQLPVQTRAEAVESLCFEATCRIEDPVYGCVGMISLLQTQIQKTESLLA 99 
                     6******************************************************************************************9999 PP

          DUF260  96 llkee 100
                     ++++e
  XP_013613397.1 100 RTQAE 104
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5754105IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-395102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNPKRCAACR YLRRRCPKDC VFSPYFPPNN PEKFACVHRI YGAGNVSKML QQLPVQTRAE  60
AVESLCFEAT CRIEDPVYGC VGMISLLQTQ IQKTESLLAR TQAEITVAQI KHSQNQHSEF  120
M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613397.13e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_013659582.13e-87PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-75LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A078GTX33e-87A0A078GTX3_BRANA; BnaC02g36230D protein
TrEMBLA0A0D2ZPE83e-87A0A0D2ZPE8_BRAOL; Uncharacterized protein
STRINGBra032938.1-P9e-78(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-65LOB domain-containing protein 24